Home > Offer to Sell > Intermediates > Pharmaceutical intermediates > ACTH (1-39) for Polypeptide special products
ACTH (1-39) for Polypeptide special products
Inquiry
| Post Date: | Dec 18,2014 |
| Expiry Date: | Jun 16,2015 |
| Detailed Description: |
Quantity: 10Kilograms Specs:USP and SGS Price:10 USD Kilograms Payment Method: T/T; Western Union; Money Gram; Bank transfe ACTH (1-39) for Polypeptide special products Quick Details: ACTH (1-39) 10mg Peptide Product Name: ACTH (1-39), Size: 10mg. Molecular Formula: C207H308N56O58S1 Molecular Weight: 4541.1 CAS: 9002-60-2 Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF Sequence (Three-Letter Code): H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH Product Description: Adrenocorticotropic hormone, commonly referred to as ACTH and also known as corticotropin, is a polypeptide hormone produced in and secreted by the anterior pituitary gland. It is a key component in the hypothalamic-pituitary-adrenal axis, often produced in response to exogenous biological stress along with corticotropin-releasing hormone (which is also from the hypothalamus.) Its effects include increased production and release of corticosteroids and, as its name suggests, cortisol from the adrenal cortex. ACTH is sometimes indicated as part of an emergency treatment for sepsis, although: Surviving Sepsis Campaign guidelines suggest that corticosteroid therapy should be considered for adult septic shock when hypotension responds poorly to adequate fluid resuscitation and vasopressors, regardless of any results of diagnostic tests. However, steroid treatment may be associated with an increase risk of infection.... Baseline cortisol level < or = 35 microg/dl is a useful diagnostic threshold for diagnosis of steroid responsiveness in Thai patients with septic shock and ACTH stimulation test should not be used. ACTH deficiency state can result from ACTH underproduction or tissue resistance; decreased production may be due to intrinsic pituitary disease (secondary) or may result from deficiency of CRH because of a hypothalamic disorder (tertiary). ACTH deficiency can be congenital or acquired, familial or sporadic, and partial or complete. It may occur as an isolated deficiency or as a part of a more global hypopituitarism. Tseng et al highlight the complex nature of ACTH deficiency as part of a larger physiological issue: SIADH-like hyponatremia as the presenting manifestation of ACTH deficiency is rare in childhood. Here we report a 14 year-old girl who, after 8 years of GH replacement and subsequent treatment for subclinical secondary hypothyroidism, presented with confusion and disorientation due to severe hyponatremia. When her pituitary axis was re-assessed, she was diagnosed as having ACTH deficiency associated with multiple pituitary hormone deficiencies (MPHD) (including GH, FSH, LH, and subclinical TSH deficiencies). She responded poorly to treatment with only hypertonic fluid, but improved after addition of hydrocortisone replacement. The purpose of this paper is to emphasize the importance of suspecting ACTH insufficiency in children with GH deficiency if hyponatremia develops. ACTH deficiency is a concern when clinicians surgically treat Cushing's syndrome, so much so that many now administer exogenous glucocorticoids pre-, peri-, and post-surgery: "The concern for ACTH deficiency has led many centers to advocate the use glucocorticoids before, during and after surgery." competitive advantage : 1. Best prices with satisfied quality ,Great quality and purity 2. Perfect Packing and safe ,fast delivery. we have sold these products for many years , our enrich experience make our products have a high rate to pass your country custom. 3. good after-sales service We can provide the easier way to help our regular clients to convert steroid powders to injectiable oil some of my customers feedback : 1. i have received my products , you packing is do discreet and perfect , it really amazed me .i will order more from you as soon as possible . thanks a lot. --------------Robet--Australia 2. i have cooperated with you for many times , your product quality is so great , that is why i still buy the products from you . thank you -----------Richard---American 3 Hi mate, your best price and high purity product is so competitive in my country , this let me make much profit , my customers are really like it . cooperate with you is so wonderful ! thak you --------------Johnson---Canada |
| Company: | Guangzhou Quanao Chemical Co.,Ltd [ China ] |
| Contact: | Candice He |
| Tel: | +86-020-31034798 |
| Fax: | 020-3103-7018 |
| Email: | candice@ycgmp.com |
-
Disclaimer statement:The information and data included above have been realized by the enterprises and compiled by the staff, and are subject to change without notice to you. The Chemnet makes no warranties or representations whatsoever regarding the facticity, accuracy and validity of such information and data. In order to ensure your interest, we suggest you chose the products posted by our gold suppliers or VIP members.
